SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025859 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025859
Domain Number 1 Region: 445-469
Classification Level Classification E-value
Superfamily Notch domain 0.0000693
Family Notch domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025859   Gene: ENSBTAG00000019409   Transcript: ENSBTAT00000025859
Sequence length 1249
Comment pep:known chromosome:UMD3.1:5:65913564:65996223:-1 gene:ENSBTAG00000019409 transcript:ENSBTAT00000025859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNTTEPTK
KSEKPLECLLTHCIKVPMLVLDPALPTNVTLKDLPSLYPSFHSASDVFNVAKPKNPSTNV
SVVVFDTTKSVEDAQAGMFKGNSRQTVWRGYLTTDKEVPGLVLMQDLAFLSGFPPTFKET
NQLKAKLPENLSSKIKLLQLYSEASVALLKLNNPKDFQELNKQTKKNMTINGKELTISPA
YLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSGASRYIAG
AGGTGSIGVGQPWHFGAGMTGVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHF
HELYKVTLLPNQTHYVVPKGECLPYFSFAEIAKKGIEGAYSDNPIIRHASIANKWKTIHL
LMHSGMNATTIHFNLTLQGKNDEEFKIQIVVEVDTREEPKRNSTTQKAYQSSMSSTTLLP
EAEILFEDIPEEKRFPKVKRHDVNTTRRFQVEVEIPQVNISLLPKETQLSLNNLDLQLER
GDITMKGYNLSKSALLRSFLMNPQNGKLTVNHPLTTEQRNGGLEAPLAKDAHKSNLGTSE
RRQGSSPVPAVTMTVNNHSQSQIPPLEARFRAITVTPKVGGRTVSREKLSSLTFPLESKD
TQEKVITGKEQEKKIEENANSYPGGNEVVPGRKLQQYTDSYLGFLPWEKKKYFQDLLDEE
ESLKTQLAYFTDSKHTGRQLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQ
ELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGILSD
REIRTLATRIHDLPLSLQDLTGLEHMLINCSKMLPANITQLNNIPPTQEAYYDPNLPPVT
KSLVTNCKPVTDKIHKAFKDKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKF
VCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYRDK
LKFWTHCVLATLIMFTVFSFFAEQLIALKRKIFPRRRIHKEASPDRIRV
Download sequence
Identical sequences F1MPB1
ENSBTAP00000025859 ENSBTAP00000025859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]