SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000025978 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000025978
Domain Number 1 Region: 8-158
Classification Level Classification E-value
Superfamily Nudix 5.96e-28
Family MutT-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000025978   Gene: ENSBTAG00000019501   Transcript: ENSBTAT00000025978
Sequence length 171
Comment pep:known_by_projection chromosome:UMD3.1:12:17960583:17967118:1 gene:ENSBTAG00000019501 transcript:ENSBTAT00000025978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASVEPRGRRPGVGVGVVVTSGRHPRCVLLGKRKGSFGAGSFQLPGGHLEFGETWEECA
QRETWEEAALHLKNVRFASVVNSFIEKENYHYVTILMKGEVDLTHDSEPKNVEPEKNESW
EWVPWEEFPPLDQLFWGLRCLKEQGYDPFKEDLDHLVGYKGSHLEVNKEIH
Download sequence
Identical sequences E1B7T3 L8HU22
ENSBTAP00000025978 ENSBTAP00000025978 XP_003582900.1.59421 XP_003586745.1.76553 XP_005908207.1.15283 XP_010832346.1.44457 9913.ENSBTAP00000025978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]