SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026064 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026064
Domain Number 1 Region: 5-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.55e-34
Family Calponin-homology domain, CH-domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 190-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000927
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 159-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000187
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026064   Gene: ENSBTAG00000037703   Transcript: ENSBTAT00000026064
Sequence length 853
Comment pep:known_by_projection chromosome:UMD3.1:5:110213001:110240434:1 gene:ENSBTAG00000037703 transcript:ENSBTAT00000026064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRGALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFDSLSKDNVF
ENNRLAFEVAEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFAGSGPAGVSSPRK
GLVLSSPPSEASTPADPGDRAQGEECSSGSLSKQGSHRTPSSTCAACQQHVHLVQRYLAD
GKLYHRHCFRCRRCSSTLLPGAYRNGPEEGTFVCAEHCARLGPSGRSGARPGTPPQPKQQ
QLTEEAKEVEGGSPSPKATAGAEADVPKASPEGRPQVPTKPRVPGRPQELASPPASRPTP
APRKASESTAPTPPTPRPRSSLQQENLVEQGGGSGLVNGKLQEPPIPKPRGTPKLSERTP
APRKDPPWITLVQAEPKKKPAPLPPSSSPGPPPGQEGRQVENGGVDKAAPRGPEPKPYNP
FEEEEEEPPAAPSPAPGPAPTPPESTPKSLHPWYGITPTSSPKTKKRPAPRAPSTSPLTL
HASRLSRSEPPSATPSPALSVESLSSESSSQAPSEELLEPPVVPKSSSEPAVHAPGTPGT
SASLSANSSLSSSGELVQPSMDRTPQASPGLAPNSRGSPGPPPAKPCSGTAPTPLVLVGD
KSPAPSPGTSSPQLQVKSSCKENPFNRKPSPTASPSVKKATKGSKPARPPAPGHGFPLIK
RKVQSDQYIPEEDIHGEIDTIERQLDALEHRGVLLEEKLRGGVNEGREDDMLVDWFKLIH
EKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRGREKVLMQELVT
LIEQRNAIVNCLDEDRQREEEEDKMLEAMIKKKEFQKETEPEGKKKGKFKTMKVLKLLGN
KRDTKSKCPGDRS
Download sequence
Identical sequences E1BBG2
ENSBTAP00000026064 ENSBTAP00000026064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]