SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026137 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026137
Domain Number 1 Region: 92-193
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-31
Family SH2 domain 0.0000561
Further Details:      
 
Domain Number 2 Region: 10-90
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000263
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026137   Gene: ENSBTAG00000040607   Transcript: ENSBTAT00000026137
Sequence length 276
Comment pep:known chromosome:UMD3.1:13:66368694:66395549:-1 gene:ENSBTAG00000040607 transcript:ENSBTAT00000026137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQPSRGKALPSPSFSPCVQGQNPEPMQAERSRAKAVALGSFPVGEQAELSLRLGEPLT
IISEDGDWWTVLSDVSGREYSIPSIHVARIAHGWLYEGLSREKAEELLLLPGNHGGAFLI
RESQTRRGCYSLSVRLSRPASWDRIKHYRIQRLDNGWLYISPRLTFPSLLALVDHYSELA
DDICCLLKEPCALRRAGPLPGKAIPPPVTVQATPLNWKELDSSLLFSEASAAGEESLLSE
GLREALNSYISLTDDTSLDDAKAESRRRKSNQGCGT
Download sequence
Identical sequences A0JNA5
ENSBTAP00000026137 9913.ENSBTAP00000026137 ENSBTAP00000026137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]