SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026158 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026158
Domain Number 1 Region: 390-493
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026158   Gene: ENSBTAG00000019636   Transcript: ENSBTAT00000026158
Sequence length 495
Comment pep:known chromosome:UMD3.1:8:10662268:10796378:1 gene:ENSBTAG00000019636 transcript:ENSBTAT00000026158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKAMYLHATVSDRDSSSIFEEPFDGRSLSKLNLCEDGPCHKGRAGGCCTQLGSLSALK
HAVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQG
ELSEQVWKAHDALQNQSDSLLALAGAVQRLEGALWGLQAQAAQSEQAVVLLRERAAQQSD
AAQLELYQLQVDSNRSQLLLRRHAGLLDGLARRVGALSDELADVGGALRGLNLSLSYDVA
LQGTRLRDLRVLVSNASEDARRLRLAHRGLELQLKQELAVLNGVTEDLRLKDWEHSIALR
NITLAKGPPGPKGDPGDAGKEGEPGIPGLPGLRGLPGERGTPGLPGPKGDEGKLGATGPM
GMRGFKGDRGPKGEKGEKGDRTVDASGVEAVMVRLVNGSGLHQGRVEVYHERRWGTVCDD
GWDKKDGDVVCRMLGFPGAEDVHRTAQFGQGTGRIWMDDVACKGTEESIFRCSFSKWGVT
NCGHAEDAGVTCKRH
Download sequence
Identical sequences A5PJQ2
ENSBTAP00000026158 ENSBTAP00000026158 NP_001095969.1.59421 NP_001095969.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]