SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026215 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026215
Domain Number 1 Region: 707-818
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000455
Further Details:      
 
Domain Number 2 Region: 151-256
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 922-1025
Classification Level Classification E-value
Superfamily SRCR-like 1.22e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000889
Further Details:      
 
Domain Number 4 Region: 258-362
Classification Level Classification E-value
Superfamily SRCR-like 7.98e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 
Domain Number 5 Region: 45-149
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00021
Further Details:      
 
Domain Number 6 Region: 470-574
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00045
Further Details:      
 
Domain Number 7 Region: 574-682
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00074
Further Details:      
 
Domain Number 8 Region: 365-469
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0014
Further Details:      
 
Domain Number 9 Region: 814-921
Classification Level Classification E-value
Superfamily SRCR-like 1.06e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026215   Gene: ENSBTAG00000019669   Transcript: ENSBTAT00000026215
Sequence length 1129
Comment pep:known chromosome:UMD3.1:5:102245937:102278444:1 gene:ENSBTAG00000019669 transcript:ENSBTAT00000026215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLHDNSGSAGFKRCSVHFGPFTLAVVSVLYACLITSALGGTDKELRLVAGQTKCSGRVE
VKVQEEWGTVCNTGWDLAAVSVVCKQLGCPSVIKATGWTNSSAGTGRIWMDHVSCRGNES
ALWDCKHEGWGKHNCTHQQDVGVTCSDGSDLEMRLMNGGNRCSGRIEIKFQGQWGTVCDD
NFNLDHASVVCKQLGCGSAVSFSGSANFGEGSGPIWFDDLVCHGNESALWNCRHEGWGKH
NCDHAEDAGVICLEGADLSLRLVDGVTKCSGRLEVRFQGEWGTVCDDGWDSDDAAVACQQ
LGCPTAITAVGRVNASEGTGHIWLDSVSCQGHESAVWQCRHHEWGKHYCNHNEDAGVTCS
DGSDLELRLKGGGSRCAGTVEVEIQKLIGKVCDRSWGLKEADVVCKQLGCGSALRTSYQV
YSKIQATNTWLFLNNCNGNETSIWDCKNWQWGGLSCEHYHEAKVTCSAHREPRLVGGDIP
CSGRVEVKHGDTWGTICDSDFSLESASVLCRELECGSVVSILGGAHFGEGNGQIWAEEFQ
CEGNESHLSLCPVAPRLDGTCSHSKDIGVVCSRYTEVRLVGGNTPCEGRVEVKILGTWGP
LCNSHWDMEDAHVLCQQLKCGVAASIPGRAPFGKGSGQPWRHMFHCTGTEQHMGDCPVTA
LGASLCPEGQVASVICSGNRSQTLYPCNSSSSDPESSVVLEENGVPCIGSGQLRLVNGGG
RCAGRIEVYHEGSWGTICDDSWDLDDAHVVCRQLGCGVAINATGSAHFGEGSGPIWLDEV
NCNGKEPRISQCRSHGWGRQNCRHKEDAGVICSEFMSLRLISDSSSETCAGRLEVFYNGA
WGSVGKSDMSATTVGVVCRQLGCTDKGSIRPAPSDKVENRYMWVDNVRCPKGPETLWQCP
SSPWKRRLASPSEETWITCADKIRLQEGTTNCSGRVEVWHGGSWGTVCDDSWDLNDAQVV
CRQLGCGLALEAGKEAAFGQGTGPIWLNEVKCKGNESSLWDCPARSWGHSDCGHKEDASV
KCSEIAESKGSVKAAGHSSTVALGILGVILLAFLIATLLWIQRRRQRQRLAVSSRGENSV
HEIQYREMNSCLKADDLDLYNSSGLWVLRGSIALGFRLVTAAEAERHST
Download sequence
Identical sequences P85521
ENSBTAP00000026215 ENSBTAP00000026215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]