SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026239 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026239
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Nudix 2.03e-24
Family MutT-like 0.000000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026239   Gene: ENSBTAG00000019684   Transcript: ENSBTAT00000026239
Sequence length 172
Comment pep:known chromosome:UMD3.1:23:8297778:8414740:-1 gene:ENSBTAG00000019684 transcript:ENSBTAT00000026239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPG
TAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVSIGRKREWF
KIEDAINVLQCHKPVQASYFETLRQGYSANNGTPLVAPTYSVSAQSSMPGIR
Download sequence
Identical sequences A2VE79
NP_001075935.1.59421 NP_001075935.1.76553 ENSBTAP00000026239 ENSBTAP00000026239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]