SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026288 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026288
Domain Number 1 Region: 47-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.81e-39
Family Ankyrin repeat 0.00053
Further Details:      
 
Domain Number 2 Region: 498-642
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.66e-36
Family Ankyrin repeat 0.00044
Further Details:      
 
Domain Number 3 Region: 323-404
Classification Level Classification E-value
Superfamily EF-hand 0.00000267
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026288   Gene: ENSBTAG00000019726   Transcript: ENSBTAT00000026288
Sequence length 776
Comment pep:known_by_projection chromosome:UMD3.1:13:3147664:3170170:1 gene:ENSBTAG00000019726 transcript:ENSBTAT00000026288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALADKRLENLQIYKVLQCVRNKDKKQIEKLTRLGYPELINFTDPVNGNSALHLASVSND
IDMVSFLLSLGAHPDVQDKMGCTPTMRAAELGHELSMEILAKAKADMTVVDNEGKGILFY
CILPTKRHYRCALIALEHGADVNNCTCEGKPIFLRACEEAHDVKDVCLTFLEKGANPNAI
NTSTGRTALMEASREGVTELVRGILERGGDVNAFDNDRHHAAHFAAKGGFFDILKLLFAY
NGDMGLIAMNGNTPLHYAAMGGFADCCKYIAQRGCDLKWKNLEHKTPRNLAKEGGFKAAS
KEIRRAEQIANKLARPGVKNPNPHLFLRLHDWSVEHETFLREAFSFVDRGDGTVTKEDFV
LTLEERQDFVNSEQLAAIAQLHEKVRGGGVNINEFFKGTRYLSKSYVLGSYGPKKKKKGM
AKRARVGKFVFPLPICIIPDHVFPRRSDGGPPYYMIETYKNVTDCNRFNRDHPPEHPIQD
DSAWYIDDPGKVFSNINFITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACATGNIDA
VKFLLEKGANVNATDNFLWTPLHFACHAGQQDIVELLVKSGAVVDALSINNSTPLSRAIE
SCRLDTVKYLLDIGAKFQLENRKGHSAMDVAKAYADSRIIGLIKEKLDNLPKPAENQKPK
GKPQPKAKTEGPEIKKEEETLSAIYTVPAIVEDKKMRKDNVVYLNSLITSGYTKKVDITF
IPQRIWSPEATTAELIRMRELRRERLTYEVDFDDFMMPFQKHITERAQAVEASFKM
Download sequence
Identical sequences E1B993
ENSBTAP00000026288 XP_001255790.1.59421 XP_002692084.1.76553 ENSBTAP00000026288 9913.ENSBTAP00000026288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]