SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026432 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026432
Domain Number 1 Region: 128-317
Classification Level Classification E-value
Superfamily PH domain-like 6.29e-64
Family Phosphotyrosine-binding domain (PTB) 0.0000000059
Further Details:      
 
Domain Number 2 Region: 471-576
Classification Level Classification E-value
Superfamily SH2 domain 6.73e-28
Family SH2 domain 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026432   Gene: ENSBTAG00000019838   Transcript: ENSBTAT00000026432
Sequence length 583
Comment pep:known chromosome:UMD3.1:3:15674437:15681845:1 gene:ENSBTAG00000019838 transcript:ENSBTAT00000026432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPVLPPVPGDDSPTTLCS
FFPRMSSLKLASPAGGRPGPKGEPGRANEDGEGVAGAATLDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPRLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGALPGAARPTPPSAQTPSHLGATLPVGQPAGGDPEARRQMPPPPPSSGRE
LFDDPSYVNVQNLDKARQAGAGAGPPNPTINGSAPRDLFDMKPFEDALRMPPPPQSTAMA
EQLRGEPWFHGKLSRREAEALLQVNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
Download sequence
Identical sequences E1B716
ENSBTAP00000040041 NP_001157533.1.59421 NP_001157533.1.76553 XP_005898722.1.15283 XP_010836623.1.44457 XP_019809827.1.53367 ENSBTAP00000026432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]