SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026533 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026533
Domain Number 1 Region: 2-124,158-265
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.67e-71
Family Calponin-homology domain, CH-domain 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026533   Gene: ENSBTAG00000019916   Transcript: ENSBTAT00000026533
Sequence length 1010
Comment pep:known_by_projection chromosome:UMD3.1:21:61618876:61653533:-1 gene:ENSBTAG00000019916 transcript:ENSBTAT00000026533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERENVQKRTFTRWINLHLEKCNPPLEVKDLFIDIQDGKILMALLEVLSGRNLLHEYKSS
SHRIFRLNNIAKALKFLEDSNVKLVSIDAAEIADGNPSLVLGLIWNIILFFQIKELTGNL
SRNSPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIRTLLAWVQRKTRKYGVA
VQDFAGSWRSGLAFLAVIKAIDPSLVDMKQALEDSMRENLGEAFSIAHDALHIPRQIKKK
YIMVDTPDEQSIVTYVAQFLEHFPELEAEDFVDSDKEAPIESTFVRIKETPSEQESAIFL
LTEDGERAYTINHEASHPPPSKVFVCDKPEDAKEPWLGGVSSQELVDSSSEFMNQIIEQV
LQGIPGKLNSTSEPAPESSILSSRKDSRRSNSLPIKKTVHFEADTYKDASCSQDPFYSAD
LHFEGSPGESKESSKQDERVLAADAAEQTPKREAPEILEVASNEVPGDMSSVDGEISHPP
TSWTSPSWNGASERASSPGDEGHLPSPPGENTVMASALEIKVKLLTVEAMDKEDYFEAIP
LKASKFNSDLIDFASTSQAFNEVPSPHEKKPAEEELSEDHPERLGKRRGKSAHKKTDSDE
APVKLDQPDPHKDPGDQDQGYSLAPEEALVDKKPEVYEKAKRKSFRRRRRGEEEGEAECL
RGLGGELPSNPPRSSVSLETLRSPSEEGLDFKPSPPLSKISVIPHDLFYYPHYEVPLAAV
LEAYAEGSEDLKNEEMDLEEPEAYLLDLGAREDEPEEAEASQSSFSFSGLGEDLPQASIA
EDASPASEPSPQPSPEDHQQREAKDSVPVQGHQSQESPNSENLASPLEEKVMEESISSKK
KEKRKHVDHVESSIFVAPGTVRSSDDLEEDTGDHKVLSRTSHSDSSIYIRRHTNRSLESD
HFSYVQLRNAADVDDRRNRMLTRYNTQKLTELILQFYGIRADMKREWKHARMSMQKANHS
GKARLREIHSSQSDSLTQLVQQPDVMYFILFLWLLVYCLLLFPQLDVNRL
Download sequence
Identical sequences E1BM27
ENSBTAP00000026533 ENSBTAP00000026533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]