SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026544 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026544
Domain Number 1 Region: 108-270
Classification Level Classification E-value
Superfamily EF-hand 1.55e-22
Family Calmodulin-like 0.016
Further Details:      
 
Domain Number 2 Region: 16-140
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000648
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026544   Gene: ENSBTAG00000019926   Transcript: ENSBTAT00000026544
Sequence length 276
Comment pep:known chromosome:UMD3.1:23:31951997:32004354:-1 gene:ENSBTAG00000019926 transcript:ENSBTAT00000026544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAREPTQGSLDAAGFWQVWQRFDVEEKGYIEEKELDAFFYHMLTKLGVDDAVKEENVQ
KMKQQFMAPHNVSKDGCIQMKELAGMFLSEDENFLLLFRQETPLDSSVEFMRIWRKYDAD
SSGFISAAELCNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDKNKDGRLDLNDLARILAL
QENFLLQFKMDACSSEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVQPSIRGV
DLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Download sequence
Identical sequences F1N1I2
9913.ENSBTAP00000026544 ENSBTAP00000026544 ENSBTAP00000026544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]