SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026577 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026577
Domain Number 1 Region: 27-147,189-351,430-435
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.86e-22
Family FAD-linked reductases, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026577   Gene: ENSBTAG00000019951   Transcript: ENSBTAT00000026577
Sequence length 492
Comment pep:known chromosome:UMD3.1:7:62752481:62764723:1 gene:ENSBTAG00000019951 transcript:ENSBTAT00000026577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAARLLAALAALLAAAATGDARPSKIAVVGAGIGGSAVAHFLQQHFGPRVQIDVFEKG
TVGGRLATISVNKQHYESGAASFHSLSLHMQGFVKQLGLRHRREVGGRSAIFNGENFVLE
ETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVEELLYSLGES
AFVNMTQRSVAESLLQVGVTQRFIDDVVSAVLRASYGQSAAMPAFAGAMSLAGAQGSLWS
VEGGNKLVCSGLLKLTKANVIHATVTTVTLQPTEGKPLYRVRYENEAGTGSDNYDIVVIA
TPLHLDNSSTIAFEGFDPPIDVVQGSFQPTIVSLVHGYLNSSYFGFPDPKLFPFANILTT
DFPTFFCALDNICPVNISASFRRKQPQEAAVWRVQSPQPLLRSQLKTLFRSYYSVQTAEW
QAHPVHSPHTPLPRFTLHDQLFHLNALEWAASSVEVTAVAAKNVALLAFNRWYQDLDKID
QKDLMHKVKTEL
Download sequence
Identical sequences Q0P5H1
9913.ENSBTAP00000026577 NP_001069141.1.59421 NP_001069141.1.76553 ENSBTAP00000026577 ENSBTAP00000026577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]