SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026661 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026661
Domain Number 1 Region: 226-498
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.43e-82
Family Protein kinases, catalytic subunit 0.0000000843
Further Details:      
 
Domain Number 2 Region: 121-264
Classification Level Classification E-value
Superfamily SH2 domain 1.17e-40
Family SH2 domain 0.0000384
Further Details:      
 
Domain Number 3 Region: 34-169
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-26
Family SH3-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026661   Gene: ENSBTAG00000020018   Transcript: ENSBTAT00000026661
Sequence length 514
Comment pep:known_by_projection chromosome:UMD3.1:9:35040651:35138636:1 gene:ENSBTAG00000020018 transcript:ENSBTAT00000026661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNLCLRLWTYLDRCFPCWWSEEVDKPGVIQNPWADCPPDPPRPPAPEPERSQGQFFVAL
FDYQARTAEDLSFHAGDKLQVLDKSHKGWWLARHLEKRADSSSQQLQGYIPSNYVAEDRS
LQAEPWFFGAIKRTDAEKQLLYSENQTGAFLIRESESQKGDFALSVLDEGVVKHYRIRRL
DEGGFFLTRRRTFSTLNEFVSHYTKTSDGLCVKLGKPCLKIQVPAPFDLSYKTVDQWEID
RSSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLI
QLYAVCTLEDPIYIITELMRHGSLQEYLQNDAGSKIHLTQQVDMAAQVASGMAYLESQNY
IHRDLAARNVLVGEHNIYKVADFGLARVFKVENEDIYESKHEIKLPVKWTAPEAIRTNKF
SIKSDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLGQNYRLPQPSNCPLQFYNIMLECW
NAEPKDRPTFETLHWKFEDYFVTESSYSDTNNFL
Download sequence
Identical sequences E1BPI3
ENSBTAP00000026661 9913.ENSBTAP00000026661 ENSBTAP00000026661 XP_002690130.1.76553 XP_586141.3.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]