SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026686 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026686
Domain Number 1 Region: 234-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-79
Family Protein kinases, catalytic subunit 0.00000000139
Further Details:      
 
Domain Number 2 Region: 124-267
Classification Level Classification E-value
Superfamily SH2 domain 9.68e-38
Family SH2 domain 0.00000891
Further Details:      
 
Domain Number 3 Region: 64-149
Classification Level Classification E-value
Superfamily SH3-domain 6.41e-22
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026686   Gene: ENSBTAG00000020034   Transcript: ENSBTAT00000026686
Sequence length 512
Comment pep:known_by_projection chromosome:UMD3.1:14:24847257:24920713:1 gene:ENSBTAG00000020034 transcript:ENSBTAT00000026686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKRKDNLNDDGVDLKTQPVRNTDRTIYVRDPTSNKHQRPVADSQLLPGQRFQTKD
PEEQGDIVIALYPYDGIHPDDLSFKKGEKMKVLEQHGEWWKAKSISTKKEGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSYSLSVRDYDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Download sequence
Identical sequences F1N261
ENSBTAP00000026686 9913.ENSBTAP00000026686 XP_006041565.1.26621 XP_006041566.1.26621 XP_019829480.1.53367 ENSBTAP00000026686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]