SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026714 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026714
Domain Number 1 Region: 78-224
Classification Level Classification E-value
Superfamily EF-hand 4.2e-41
Family Calmodulin-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026714   Gene: ENSBTAG00000020049   Transcript: ENSBTAT00000026714
Sequence length 226
Comment pep:known chromosome:UMD3.1:17:65154254:65170682:1 gene:ENSBTAG00000020049 transcript:ENSBTAT00000026714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCVKSPLRNLSRKMRQEETSYTVVQTSEEGLAASGELPGPLLMLAQNCAVMHNLLGPA
CIFLRKGFAENRQPDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEM
ELIELSQQINMNLGGHVDFDDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEIST
SELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Download sequence
Identical sequences Q9N1R0
NP_776679.1.59421 NP_776679.1.76553 XP_004281461.1.21590 XP_004315368.1.83887 XP_007448258.1.90284 XP_019833635.1.53367 ENSBTAP00000026714 ENSBTAP00000042361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]