SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026804 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026804
Domain Number 1 Region: 147-344
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.16e-57
Family Prokaryotic proteases 0.000000019
Further Details:      
 
Domain Number 2 Region: 359-455
Classification Level Classification E-value
Superfamily PDZ domain-like 1.14e-23
Family HtrA-like serine proteases 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026804   Gene: ENSBTAG00000020124   Transcript: ENSBTAT00000026804
Sequence length 458
Comment pep:known chromosome:UMD3.1:11:10089786:10093086:-1 gene:ENSBTAG00000020124 transcript:ENSBTAT00000026804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRAGRGAGWSLRGWRALWGGRWGKGPLLTPDLRALLTSGTPDPRTRVTYGTPSFRAR
LSVGVPEPRTCLRSRTSDLRARLIAGTPDPRTPEDSGTPGTRLRVWLAVALGAGGAVLLL
FWGGGRGPPAVLASVLGSPPTSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLPSGDTYEAVVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPAKDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTSGISFAIPSDRLREFLHRGEKKNSWFGISGSQRR
YIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLRPGDVILAIGEQL
VQNAEDIYEAVRTQSQLAVRIRRGQETLTLYVTPEVTE
Download sequence
Identical sequences A0JNK3
ENSBTAP00000026804 ENSBTAP00000026804 NP_001071424.1.59421 NP_001071424.1.76553 XP_019825429.1.53367 9913.ENSBTAP00000026804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]