SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026900 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026900
Domain Number 1 Region: 148-524
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 5.56e-96
Family Phosphonoacetate hydrolase 0.039
Further Details:      
 
Domain Number 2 Region: 617-854
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.82e-25
Family DNA/RNA non-specific endonuclease 0.016
Further Details:      
 
Domain Number 3 Region: 51-99
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000301
Family Somatomedin B domain 0.0043
Further Details:      
 
Domain Number 4 Region: 97-141
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000115
Family Somatomedin B domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026900   Gene: ENSBTAG00000020196   Transcript: ENSBTAT00000026900
Sequence length 874
Comment pep:known chromosome:UMD3.1:9:70588607:70673279:1 gene:ENSBTAG00000020196 transcript:ENSBTAT00000026900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTLNLSTEEPVKRNTVKKYKIICIVLLILLVAVSLALGLVAGLRQQEEQGSCRKKCFD
ASHRGLEGCRCDAGCKGRGDCCWDFEDTCVQSTQIWTCNKFRCGETRLESSLCSCSDDCL
QRKDCCADYKSVCQGETSWVDEDCSTAQQPQCPEGFDLPPVILFSMDGFRAEYLQTWSTL
VPNINKLKTCGVHSQYLRPAYPTKTFPNHYTIVTGLYPESHGIIDNNMYDINLNKNFSLS
SKEKDNPAWWQGQPIWLTAMYQGLKVGTYFWPGSDVAINGTFPSIYKIYNRSVTYEERIF
TLLKWLDLPKAERPDFYTIYVEEPDSQGHNYGPVSAGVIQALQLVDKTFGLLMEGLKQRN
LVNCVNIILLADHGMDQTYCDKLEYMADYFSSINFYMFEGPAPRIRTRNIPQDFFTFNSE
EIVRNLSCRKPDQHFKPYLSPDLPKRLHFAKNVRIDKVNLLVDRQWQAVRNRAYSYCGGG
NHGYDNEFKSMEAIFLAHGPSFKQKTEVEPFDNIEVYNLLCDLLHIQPAPNNGTHGSLNH
LLKVPFYEPSHAEELSKFSVCGFTVPLPTDTLGCSCSRLQTNSDLERVNQMLDLTQDEIT
ATEKLNLPFGRPRLIQKNKEPCLLYHREYVSGFDKTLRMPLWSSYTVPKPGDTSPLPPTV
PDCLRADVRVAPSESQNCSFSLADKNITHGFLYPPANNRTSNSQYDALITSNLVPMYEAF
KTMWNYFHSVLLVKYAMERNGVNVVSGPVFDYDYDGHFDAPDEIADYAVNTSVPIPTHYF
VVLTSCKNQSQTPDACTGWLDVLPFVIPHRPTNVESCPENKSESLWVEERFNVHTARVRD
VELLTGLDFYQEKAQPVSEILQLKTYLPVFETVI
Download sequence
Identical sequences G8JKZ1
ENSBTAP00000026900 ENSBTAP00000026900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]