SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000026904 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000026904
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily EF-hand 2.33e-25
Family S100 proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000026904   Gene: ENSBTAG00000020201   Transcript: ENSBTAT00000026904
Sequence length 99
Comment pep:known chromosome:UMD3.1:10:7992986:7995677:1 gene:ENSBTAG00000020201 transcript:ENSBTAT00000026904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTQLEIAMNIMIRTFHRYSCREGDRFKLNKGELKMLLQRELTEFLSCQKDPELVDKIMQ
DLDANKDNEVDFNEFVVMVAALTVACNDYFVEQLKKKGK
Download sequence
Identical sequences F1N4J8
ENSBTAP00000026904 ENSBTAP00000026904 NP_001179595.1.59421 NP_001179595.1.76553 XP_005890147.1.15283 XP_010845919.1.44457 XP_019823538.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]