SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027029 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027029
Domain Number 1 Region: 227-378
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.38e-44
Family Dual specificity phosphatase-like 0.0000205
Further Details:      
 
Domain Number 2 Region: 61-204
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 6.4e-24
Family Cell cycle control phosphatase, catalytic domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027029   Gene: ENSBTAG00000020283   Transcript: ENSBTAT00000027029
Sequence length 444
Comment pep:known_by_projection chromosome:UMD3.1:26:31326729:31338433:1 gene:ENSBTAG00000020283 transcript:ENSBTAT00000027029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVARPGAERAGRERRVERPLRRRARSAGRSPVGSSSWASPAGTLAVGTCGAHGAGPLGGG
MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASSVRGSLNVNLNSVVLRRARGGAV
SARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGP
RVYFLKGGYETFYSEYPECCVDVKPISQEKVETERALISQCGKSVLNISYRPAYDQGGPV
EILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACTMHLHYKWIPVEDSNAADISS
HFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFHLKEAFDYIKQRRSVV
SPNFGFMGQLLQYESEILPSAPAPQAPSCQGEAAGPSFLAHLQTLSPDVQASYCTFPTSV
LAPVPTHSTASELSQSPLATATSC
Download sequence
Identical sequences F1MQM7
ENSBTAP00000027029 ENSBTAP00000027029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]