SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027046 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027046
Domain Number 1 Region: 243-523
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000014
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-28
Family SH2 domain 0.0000108
Further Details:      
 
Domain Number 3 Region: 92-213
Classification Level Classification E-value
Superfamily SH2 domain 1.32e-25
Family SH2 domain 0.0000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027046   Gene: ENSBTAG00000020294   Transcript: ENSBTAT00000027046
Sequence length 593
Comment pep:known chromosome:UMD3.1:5:103862679:103872171:-1 gene:ENSBTAG00000020294 transcript:ENSBTAT00000027046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGG
SETFDSLTDLVEHFKRTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEETA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVVLQGRDSNIPGSD
YINANYVKNQLLGPDENAKTYIASQGCLEATVNDFWQMVWQENTCVIVMTTREVEKGRNK
CVPYWPEVGSQRVYGPYTVTNCGEHDTTEYKLRNLQVSPLENENLIREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVMQSQKGRESEYGNIT
YPPAMKNAHAKASRTSSKEDVYENVHSKNKKEEKVKKQRSADKEKNKGSLKRK
Download sequence
Identical sequences A5D980
9913.ENSBTAP00000027046 ENSBTAP00000027046 NP_001091486.1.59421 NP_001091486.1.76553 XP_005907553.1.15283 ENSBTAP00000027046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]