SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027093 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027093
Domain Number 1 Region: 37-222,346-463
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.65e-49
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027093   Gene: ENSBTAG00000020331   Transcript: ENSBTAT00000027093
Sequence length 469
Comment pep:known chromosome:UMD3.1:10:85725236:85740089:1 gene:ENSBTAG00000020331 transcript:ENSBTAT00000027093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQLARVRWGTVFAAAQKGPRVSCRRWAGASADNVYDVVVSGGGLVGAAMACALGHDIH
FCDKKILLLEAGPKKVLEKLPETYSNRVSSISPGSATLLSSFGAWDHICNMRCRAFRRMQ
VWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSDQVTVLYKSKAVSYTWPYP
FSMADSSPWVHITLGDGRTLQTKLLIGADGHNSGVRQAAGIRNVSWNYDQSAVVATLHLS
EATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMEEEEFVDAINSAFWS
DVNHTDFIDSAGSMLQSAVAFLKPTRVSARQLPPSVARVDAKSRVLFPLGLGHAAEYVRP
RLALIGDAAHRVHPLAGQGVNMGFGDISSLLHHLSTAAFNGKDLGSMSHLTSYETDRQRH
NTALLAATDLLKRLYSTRATLVVLLRTWGLQATNAVSPLKEQIMAFASK
Download sequence
Identical sequences Q2KIL4
ENSBTAP00000027093 ENSBTAP00000027093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]