SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027115 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027115
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.15e-47
Family Calponin-homology domain, CH-domain 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027115   Gene: ENSBTAG00000020345   Transcript: ENSBTAT00000027115
Sequence length 329
Comment pep:known chromosome:UMD3.1:3:48763975:48794136:1 gene:ENSBTAG00000020345 transcript:ENSBTAT00000027115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGANFQLGLKDGIILCE
LINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQT
TLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDY
QAEYPDEYHGEYQDDYPRDYQYGDQGIDY
Download sequence
Identical sequences Q32L92
ENSBTAP00000027115 NP_001033268.1.59421 NP_001033268.1.76553 XP_006057628.1.26621 XP_010858789.1.44457 XP_012001049.1.54773 XP_017901282.1.57651 XP_020725030.1.74333 9913.ENSBTAP00000027115 ENSBTAP00000027115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]