SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027120 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027120
Domain Number 1 Region: 162-310
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.12e-44
Family Dual specificity phosphatase-like 0.000000385
Further Details:      
 
Domain Number 2 Region: 6-148
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.47e-19
Family Cell cycle control phosphatase, catalytic domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027120   Gene: ENSBTAG00000020350   Transcript: ENSBTAT00000027120
Sequence length 314
Comment pep:known chromosome:UMD3.1:11:2250455:2252492:-1 gene:ENSBTAG00000020350 transcript:ENSBTAT00000027120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLEAARELDCAALGALLREPREAERTLVLDCRPFLAFCRRHVRAARPVPWNALLRRRAR
GPPAAALACLLPDRALRARLARGELARAVVLDEGSASVADLPPDGPAHALLAALLHETRA
GPTAVCFLPGGFDRFQACCPDLCSESPVPAMTPDNNDNSRSDSRAPSYDQGGPVEILPYL
YLGSCSHSSDLQGLRACGITAVLNVSASCPNHFEGLLRYKSIPVEDNQMVEISAWFPEAI
GFIDSVKNSGGRVLVHCQAGISRSATICLAYLIQSRRVRLDEAFDFVKQRRGVISPNFSF
MGQLLQFETQVLCH
Download sequence
Identical sequences F1MP34
NP_001179108.1.59421 NP_001179108.1.76553 ENSBTAP00000027120 ENSBTAP00000027120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]