SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027370 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027370
Domain Number 1 Region: 379-505
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-26
Family SH2 domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027370   Gene: ENSBTAG00000020542   Transcript: ENSBTAT00000027370
Sequence length 522
Comment pep:known chromosome:UMD3.1:3:16143799:16162170:1 gene:ENSBTAG00000020542 transcript:ENSBTAT00000027370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWPPVPGASPCLSWASSLACSAATTLLSRAGRAPLMAAKWFKEFPLNLKTVSERAKPGG
GGGGKLRKNSETGGSGPAPGKGRKNSAAELGSGRAGVGPAKDSRLSRDSLQGLIQAAAGK
GRKNSRATEEEPHRGAAKSSGCSTYINRLIKVDTQEKNGKSNYPSSSSSSSSSSSSSSSA
SSSPSSLGPELDKGKIIKQQDTVIILEDYADPYDAKRTKGQRDAERVGENDGYMEPYDAQ
QMITEIRRRGSKDPLVKALQLLDSPCEPGENGPKPEALTKRRSSKELLGKSPQLYDTPYE
PAAEAGPFAAEGPERKARLPPDSHGRLPQDDERPAAEYEQPWEWKKEQIVRALSVQFEGS
ERPSVKEEAARQHHRQKSWTQKILKPALTDHSEGERVDPALPLEKQPWYHGAITRAEAES
RLQSCKEAAYLVRNSESGTSRYSIALKTSQGCVHIIVAQTKDNKYTLNQTSAVFGSIPEV
VHYYSSEKLPFKGAEHMTLLYPVHSKLHQGPASKSPSGASHT
Download sequence
Identical sequences F1N7A7
ENSBTAP00000027370 ENSBTAP00000027370 9913.ENSBTAP00000027370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]