SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027388 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027388
Domain Number 1 Region: 31-111
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000522
Family Calmodulin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027388   Gene: ENSBTAG00000020554   Transcript: ENSBTAT00000027388
Sequence length 147
Comment pep:known chromosome:UMD3.1:23:27503183:27505457:-1 gene:ENSBTAG00000020554 transcript:ENSBTAT00000027388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETRDLQGGKAFGLRKAQQEERINEINQQFLDDPKYSSDEDLPSKLEAFKKKYMEFDLN
EDGGIDIMSLKRMMEKLGVPKTHLELKKLIMEVSSGPGETFSYSDFLKMMLGKRSAILKM
ILMYEEKAREQEKPTGLPAKKAISELP
Download sequence
Identical sequences L8I3S7 Q9BDK2
ENSBTAP00000027388 ENSBTAP00000027388 NP_776410.1.59421 NP_776410.1.76553 XP_005904243.1.15283 XP_006041997.1.26621 XP_019841015.1.53367 9913.ENSBTAP00000027388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]