SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027399 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027399
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.96e-51
Family C-type lysozyme 0.00000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027399   Gene: ENSBTAG00000046628   Transcript: ENSBTAT00000027399
Sequence length 147
Comment pep:known chromosome:UMD3.1:5:44631281:44638274:-1 gene:ENSBTAG00000046628 transcript:ENSBTAT00000027399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALIILGFLFLSVAVQGKVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPSSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENDIAKAVACAKHIVSE
QGITAWVAWKSHCRDHDVSSYVQGCTL
Download sequence
Identical sequences Q06284
ENSBTAP00000027399 NP_776529.1.59421 NP_776529.1.76553 ENSBTAP00000027399 9913.ENSBTAP00000027399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]