SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027417 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027417
Domain Number 1 Region: 1-279
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-88
Family Eukaryotic proteases 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027417   Gene: ENSBTAG00000040394   Transcript: ENSBTAT00000027417
Sequence length 313
Comment pep:known_by_projection chromosome:UMD3.1:25:2126944:2133828:-1 gene:ENSBTAG00000040394 transcript:ENSBTAT00000027417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQVLAAVLLLLLLRSVSGTRGGEALNACGRPRMLNRMVGGQNALEGEWPWQVSIQRNGS
HFCGGSLITDRWVLTAAHCFSNTSETSLYQVLLGVLQLARPGPHAVYARVKRVESNPKYQ
GMASSADVALVELEAPVTFTNYILPVCVPDPSVVFESGMKCWVTGWGTPSEQDSLPKPRT
LQKLAVPIISTPKCNLLYSKDAESGFQPRTIKDDMLCAGFAEGKRDACKGDSGGPLVCLV
GQVWLQAGVISWGEGCARRNRPGVYIRLTSHHDWIHRIIPELQFQRAGPGSAQKRDPRTR
QPLGRNSARYPAA
Download sequence
Identical sequences F1N7F5
ENSBTAP00000027417 ENSBTAP00000027417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]