SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027425 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027425
Domain Number 1 Region: 1-279
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-89
Family Eukaryotic proteases 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027425   Gene: ENSBTAG00000034368   Transcript: ENSBTAT00000027425
Sequence length 280
Comment pep:known_by_projection chromosome:UMD3.1:25:2272632:2275410:1 gene:ENSBTAG00000034368 transcript:ENSBTAT00000027425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWASSLQVLLLLLLAGSRLHKNLASTCGQPRVSSRIVGGRDARAGEWPWQASIQHRGAH
VCGGSLIAPQWVLTAAHCFPRKALPADYRVRLGAPHLGPSSPPALLAPVRRVLLPPDYSE
DGAHGDLALLLLRRPTPLSTRVQPVCLPEPGARPPPGTPCWVTGWGSLRPGVPLPEWRPL
QGVRVPLLDAHTCDHLYHLGTDVPRAEHIVLPGSLCAGYVGGQKDACQGDSGGPLVCMKS
GRWILVGVVSWGKGCALPNRPGVYTNVATYSPWIQAHLNI
Download sequence
Identical sequences E1BCU4
ENSBTAP00000027425 ENSBTAP00000027425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]