SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027444 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027444
Domain Number 1 Region: 1-232
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0039
Further Details:      
 
Domain Number 2 Region: 312-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000304
Family FAD/NAD-linked reductases, N-terminal and central domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027444   Gene: ENSBTAG00000020597   Transcript: ENSBTAT00000027444
Sequence length 532
Comment pep:known chromosome:UMD3.1:16:39506590:39531949:1 gene:ENSBTAG00000020597 transcript:ENSBTAT00000027444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKKVAIIGAGISGLASIRNCLEEGLEPTCFEKGEDIGGLWKFSDHVEEGRASIYRSVFT
NSSKEMTCFPDFPFPDDFPNFMHNSKLQEYITMFAKEKNLLKYIQFKTIVSSVNKRPDFQ
TTGQWDVITEKDGKKESAVFDAVMICSGHHVYPNIPKESFPGIKLFKGKCFHSRDYKEPG
IFKGKRVLVIGLGNSGCDIASELSHIAEKVIISSRSGSWVMSRVWDEGYPWDMLFITRFE
TFLKNTLPTVISNWWYMKQMNARFKHENYGLMPLNSTLRKEPVFNDELPACILCGIVTIK
PNVKEFTEDSAIFEDGTVFKAIDYVIFATGYSYAYPFLDDSIIKSRDNEVTLFKGIFPPP
LEKPTLAVIGLVQSLGAAIPTTDLQSRWAVQVIKGTCPLPSVKDMMNDIDEKMGKKLKLF
GKSDTIQTDYVVYMDELASFIGAKPNIPWLFLTDPKLALEVYFGPCTPYQFRLVGPGKWP
GARNAILTQWDRLLKPMTTRVVGSPLKPCLFCNWFRPVLISVVSIAALIVLF
Download sequence
Identical sequences Q8HYJ9
NP_776482.1.59421 NP_776482.1.76553 ENSBTAP00000027198 ENSBTAP00000027444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]