SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027457 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027457
Domain Number 1 Region: 334-455
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000027457
Domain Number - Region: 23-79
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0759
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027457   Gene: ENSBTAG00000020605   Transcript: ENSBTAT00000027457
Sequence length 458
Comment pep:known chromosome:UMD3.1:19:25702553:25724157:-1 gene:ENSBTAG00000020605 transcript:ENSBTAT00000027457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESAPDAEEARTVREALGRYEAALEGAVRALHEDMQGLQRGVEQRVAEALRLAGPLARTV
AELQRDNQRLQTQLERLTRQVESLGLTTGLAPAPGTPSPPPAPGVPNRAPRLGTARFASH
ATFSLSGRSQSLDHHDEASELEMRRTSNSCIIENGHQPGADPGDGPPEATQTIPAPEPPK
PRPVSLSLRLPHQPVTAVTRVSERFSGETSATALSPTSAAILGGLSSSPSEATTPWTPSP
SEKNSSLPRSLSSSGFGAMTASRNNNSPPLVTPPQSPPSPQPPATTQAHRPGERRRELVR
SQTLPRTSGAQARKALFEKWEQDTAGKGKGETRAKLKRSQSFGVASASSIKQILLEWCRS
KTLGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRRQNFELAFTMAENLA
NCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences Q2KI85
ENSBTAP00000027457 ENSBTAP00000027457 NP_001039785.1.59421 NP_001039785.1.76553 9913.ENSBTAP00000027457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]