SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027670 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027670
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-44
Family Calponin-homology domain, CH-domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027670   Gene: ENSBTAG00000020764   Transcript: ENSBTAT00000027670
Sequence length 288
Comment pep:known chromosome:UMD3.1:7:45159981:45162941:1 gene:ENSBTAG00000020764 transcript:ENSBTAT00000027670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQSKYDPQKEAELRSWIEGLTGLSVGPDFQKGLKDGIILCTLMNKLQPGSVPKINRSMQN
WHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNLTQVQVSLLALAGKAKTKGLQSGVD
IGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPM
DHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQV
FGLGRQIYDPKYCPQGPAADGAPAAAGDGPGPGEPSECPPYYQEEAGY
Download sequence
Identical sequences F1MHV8
ENSBTAP00000027670 ENSBTAP00000027670 9913.ENSBTAP00000027670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]