SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027674 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027674
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily SH2 domain 0.000000132
Family SH2 domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027674   Gene: ENSBTAG00000020767   Transcript: ENSBTAT00000027674
Sequence length 88
Comment pep:known chromosome:UMD3.1:3:7070264:7074707:-1 gene:ENSBTAG00000020767 transcript:ENSBTAT00000027674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKNFVYTYRIFKEKHGYFHIQTAEGIRRQIFPNLKELISKFEEPHQGLMFHLVKPIKRTG
SCLRWRRSKIELDGIYENSGSDYVDVLP
Download sequence
Identical sequences E1BI75
ENSBTAP00000027674 ENSBTAP00000027674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]