SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027772 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027772
Domain Number 1 Region: 57-290
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.36e-81
Family Eukaryotic proteases 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027772   Gene: ENSBTAG00000015125   Transcript: ENSBTAT00000027772
Sequence length 293
Comment pep:known_by_projection chromosome:UMD3.1:18:57391817:57401354:-1 gene:ENSBTAG00000015125 transcript:ENSBTAT00000027772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGAPWSWMVHALIAALILGAKDPVLGNDVASCDDPSAFGPSGSTPDLRPGATEDTRA
DESSSRIVNGTDCERNSQPWQAALLVRFNKLYCGAVLVDPQWLLTAAHCRKQFFRVRLGH
HSLSPMYESGQQLLKGIKSIPHPGYSHPGHSNDLMLIKLNKRIRETPYVRPINIASRCPS
AGTSCLVSGWGTTSSPQVTFPKALQCLNITVLSDDQCKKAYPNQIDNTMFCAGDQAGRDS
CQGDSGGPVVCNGSLQGLVSWGDFPCAQPNRPGVYTNLCRFTKWIQDTIKCNS
Download sequence
Identical sequences E1BGD9
ENSBTAP00000027772 XP_005219420.1.76553 ENSBTAP00000027772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]