SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027820 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027820
Domain Number 1 Region: 114-376
Classification Level Classification E-value
Superfamily Caspase-like 3.44e-82
Family Caspase catalytic domain 0.0000000632
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily DEATH domain 4.12e-16
Family Caspase recruitment domain, CARD 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027820   Gene: ENSBTAG00000020884   Transcript: ENSBTAT00000027820
Sequence length 377
Comment pep:known chromosome:UMD3.1:15:3474706:3494168:1 gene:ENSBTAG00000020884 transcript:ENSBTAT00000027820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDKHNKNPLKMLESLGKELISGLLDDFVEKNVLKLEEEEKKKIYDAKLQDKARVLVDS
IRQKNQEAGQVFVQTFLNIDKNSTSIKAPEETVAGPDESVGSAATLKLCPHEEFLKLCKE
RAGEIYPIKERKDRTRLALIICNTEFDHMPPRNGAALDILGMKQLLEGLGYTVEVEEKLT
ARDMESVLWKFAAREEHKSSDSTFLVFMSHGILDGICGTMHSEEEPDVLPYDTIFRTFNN
RNCLSLKDKPKVIIVQACRGANRGELWVSDSPPALADSFSQSSENLEEDAVYKTHVEKDF
IAFCSSTPHNVSWRDIKKGSLFITRLITCFQKYAWCCHLEEVFRKVQQSFEKPNVKAQMP
TVERLSMTRYFYLFPGN
Download sequence
Identical sequences O75601 Q5E9C1
NP_788811.1.59421 NP_788811.1.76553 XP_019831124.1.53367 ENSBTAP00000027820 ENSBTAP00000027820 9913.ENSBTAP00000027820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]