SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027857 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027857
Domain Number 1 Region: 814-1092
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.12e-69
Family Protein kinases, catalytic subunit 0.00000694
Further Details:      
 
Domain Number 2 Region: 509-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.67e-43
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 3 Region: 374-477,514-538
Classification Level Classification E-value
Superfamily SH2 domain 7.39e-17
Family SH2 domain 0.003
Further Details:      
 
Domain Number 4 Region: 252-362
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000295
Family Third domain of FERM 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027857   Gene: ENSBTAG00000020904   Transcript: ENSBTAT00000027857
Sequence length 1105
Comment pep:known_by_projection chromosome:UMD3.1:7:5236645:5249994:1 gene:ENSBTAG00000020904 transcript:ENSBTAT00000027857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPSEETPLISQRSCSLSSSEAGALHVLLPPRGPGPPQCLSFSFGDHSAEDLCVCAAKA
SGILPVYHSLFALALEDLSCWFPPSHIFSVEDTGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLTSAILDLPVLEHLFAQHRHDLVSGRLRVGLSLKEQGECLSLAVLDLARMALEQAQR
PEELLKTVSYKVCLPPGLRDLIQGLSFVTRRRIRRTVCRALRGVATCQADRHSLMVKYIM
DLERLDPDRAAETFRVGLPGAAGGQDTPGLLRVAGGSGIAWSPGEHEVLQPFCDFPEIVD
ISIKQAPCIGPAAEHRLVTITRTDNQILEAEFPGLPAALSFVALVDGYFRLTTDSRHYFC
REVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSYLLTVCVLTP
LGPDYKGCLIRCDPTGTFSLAGLGRSHSSLRELLAACWNGGLHVDGVELYLTFCCNPRPK
EKSNLIVVRRGCNPPTSSPVQPQFQCQLSQMTFHKIPADSLQWHENLGHGSFTKIYRGCH
HEIVDGEARETEVLLKVMDAKHKNCMESFLEAASLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVRLGALDTYLRKCGHLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGT
DGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GVTVPISTLEPAKKLQFYQERQQLPAPKWMELALLIQQCMAYEPGQRPSFRAVIRDLNSL
ITSADYELLSDPTPGTLAPRDGLWNGTQLYACQDPTIFEERHLKYISQLGKGNFGSVELC
RYDPLGDNTGALVAVKQLQHSGPEQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLR
LVMEYLPSGCLRDFLQRHRARLDAGRLLLYASQICKGMEYLGSCRCLHRDLAARNILVES
ETHVKIADFGLAKLLPLDKEYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYE
LFTYSDKNCSPSAEFLRMMGCERDVPALCRLLELLAEGQRLPAPPACPSEVHELMKLCWA
PNPQDRPSFSALGPQLDALWSGSRG
Download sequence
Identical sequences E1BEL4
ENSBTAP00000027857 ENSBTAP00000027857 9913.ENSBTAP00000027857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]