SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027880 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027880
Domain Number 1 Region: 274-468
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000044
Further Details:      
 
Domain Number 2 Region: 24-160
Classification Level Classification E-value
Superfamily SH2 domain 1.17e-26
Family SH2 domain 0.000000103
Further Details:      
 
Domain Number 3 Region: 204-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.22e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027880   Gene: ENSBTAG00000020931   Transcript: ENSBTAT00000027880
Sequence length 468
Comment pep:known chromosome:UMD3.1:4:67065205:67401294:-1 gene:ENSBTAG00000020931 transcript:ENSBTAT00000027880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPGEVENRPKYYGREF
HGIISREKADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFYDGKHFVGEKRF
ESIHDLVTDGLITLYIETKASEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNESRKA
SVTNEEHTPVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLP
IPVITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences Q0VD41
XP_005205546.1.76553 XP_006055731.1.26621 ENSBTAP00000027880 ENSBTAP00000027880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]