SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027883 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027883
Domain Number 1 Region: 237-360
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-27
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 2 Region: 118-198
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 0.000000326
Family ATP sulfurylase catalytic domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027883   Gene: ENSBTAG00000020934   Transcript: ENSBTAT00000027883
Sequence length 366
Comment pep:known_by_projection chromosome:UMD3.1:10:65471177:65490132:1 gene:ENSBTAG00000020934 transcript:ENSBTAT00000027883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSGAPPAGXPAPPPDILAAYRLQRERDFEDPYSGGPSGTATLATPSAPGPTPPPRHGS
PPHRLIRVETPGPPAPPPEERISGHPASSDRLAILEDYADPFDVQETGEGPIGAAGAPEK
VPENDGYMEPYEAQKMMAEIRGSKETAAQPLPLYDTPYEPEEEGATPEGEGAPWPRESRL
PEDDERPPEEYDQPWEWKKERISKAFAAQFEGSEKSCLSPGREEKGRLPPRLSAGNPKSA
KPLSMEPSSPLGEWTDPALPLENQVWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDF
SLSLKSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYP
VAIRTL
Download sequence
Identical sequences F6RFU1
ENSBTAP00000027883 ENSBTAP00000027883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]