SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027954 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027954
Domain Number 1 Region: 136-341
Classification Level Classification E-value
Superfamily Rhomboid-like 3.79e-34
Family Rhomboid-like 0.0049
Further Details:      
 
Domain Number 2 Region: 22-76
Classification Level Classification E-value
Superfamily EF-hand 0.00000000277
Family Calmodulin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027954   Gene: ENSBTAG00000020992   Transcript: ENSBTAT00000027954
Sequence length 381
Comment pep:known_by_projection chromosome:UMD3.1:19:18160728:18192076:-1 gene:ENSBTAG00000020992 transcript:ENSBTAT00000027954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGACRWRDGAPLTPLLCVLLPQFDPGNTGFISTGKFRSLLDSHSSKLDPHKREVLLALAD
SHANGQICYQDFVNLMSNKRSNSFRQAILQGNRRLCSKALLEEKGLNLSQRLIRHVAYET
LPREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYNGVSLGQFVLQVTHPRYLKNPLVY
HPQLRAQAWRYLTYIFMHAGIEHLGLNVVLQLLVGVPLEMVHGATRIGLVYVAGVVAGSL
AVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAV
WLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRNYEQRLQDQSLWWIFVAMYTVFVL
FAVFWNIFAYTLLDLKLPPPP
Download sequence
Identical sequences F1MBG2
ENSBTAP00000027954 9913.ENSBTAP00000027954 ENSBTAP00000027954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]