SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028063 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028063
Domain Number 1 Region: 21-142
Classification Level Classification E-value
Superfamily EF-hand 2.53e-38
Family EF-hand modules in multidomain proteins 0.0057
Further Details:      
 
Domain Number 2 Region: 144-236
Classification Level Classification E-value
Superfamily EF-hand 9.4e-32
Family EF-hand modules in multidomain proteins 0.0024
Further Details:      
 
Domain Number 3 Region: 219-300
Classification Level Classification E-value
Superfamily RING/U-box 1.09e-19
Family ZZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028063   Gene: ENSBTAG00000021072   Transcript: ENSBTAT00000028063
Sequence length 627
Comment pep:known_by_projection chromosome:UMD3.1:11:73724474:73935363:1 gene:ENSBTAG00000021072 transcript:ENSBTAT00000028063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIE
AFRDNGLNTLDHSTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYD
SEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTA
VFEGPSFGYTEHSVRTCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHP
VECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHASGPHSNQHQMKEHSSWKSPAKKLS
HAISKSLGCVPTREPPHPVFPEQPEKPLDLANIVPPRPPTNLNDTMVSHMSSGAPTPTKR
LQYSQDIPSHLADEHALIASYVARLQHCARVLDSPSRLDEEHRLIARYAARLAAEAGNMT
RPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLA
ELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKEEEQKQAAQATGSPHTSPTHGG
GRPIPMPVRSTSAGSTPTHCPQDPLSGVGGDMQEAFAQGTRRNLRNDLLVAADSITNTMS
SLVKELHSAGEGAEEEEEKMQNGKDRG
Download sequence
Identical sequences E1BJB8
ENSBTAP00000028063 ENSBTAP00000028063 NP_001179729.1.59421 NP_001179729.1.76553 XP_005895747.1.15283 XP_019826159.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]