SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028127 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028127
Domain Number 1 Region: 370-478
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000776
Further Details:      
 
Domain Number 2 Region: 594-706
Classification Level Classification E-value
Superfamily SRCR-like 1.11e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 25-133
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 4 Region: 237-344
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0056
Further Details:      
 
Domain Number 5 Region: 477-581
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 6 Region: 134-237
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028127   Gene: ENSBTAG00000039470   Transcript: ENSBTAT00000028127
Sequence length 835
Comment pep:novel chromosome:UMD3.1:5:103132709:103261137:-1 gene:ENSBTAG00000039470 transcript:ENSBTAT00000028127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGRHLSLQGLCVLLLGTMVGGQALELRLKDGAHHCEGRVEVKHQGEWGTVNDVKWSLK
DASIVCRQLGCGAAIGFPGGAYFGPGLGPIWLLYTSCDGTESTVSDCRHSNIIDYRNDSY
SHDWDAGVVCSGFVRLVGDDGPCSGRVEVRPGEDWTPVSDGNFTLPTAQVICAELGCGEA
VSVLGHELFRESDGQVWAEEFRCEGKERKLWWCPRVPCPGGTCHHSGAAQVVCSAYSEVR
LMTNGSSQCEGQVEMKISGRWRALCASHWSLANANVVCRQLGCGVAISTPRGPHLVERGD
QISTVRFHCSGAESFLWSCPVTALGGPDCSHGNTASVTCSGNQTRVLPQCNDSVSEPAGS
VASEESAPYCLDSRQLRLVDGGGPCAGRVEILDQGSWGTICDDGWDLDDARVVCRQLGCG
EALNATRSAHFGEGPGPIWLDDLNCTGKESHVWRCPSRGWGRHDCRHKEDAGVICSEFLA
LRMVSGDQECAGWLEVFYNGTWGSVCRSPMDDVTVSIICSQLGCGDSGSLNTSVGLREGS
RPHWVDGIQCQRTDPSLWQCPSDPWNYNSCFPKEEAYISCAVRRPKSCPTAASCTDREKL
RLRGGDSECSGRVEVWHSGSWGTVCDDSWSLAEAEVVCQQLGCGQALEAVQAATFGPGNG
SIWLDEVRCGGRESSLWDCAAEPWGQSDCKHKEDAGVRCSGVRTTLPMTTAALSSYEDTL
AEAVYEELDYLLTQKEGLGSPDQRTDVPAENYDDAEEVPVPGTPSPSQGSEEEVSPEKED
GVRSSQTGSCLNFSREAADPGEGEESFWLLQGKKGDAGYDDVELSALGTSPVTFS
Download sequence
Identical sequences F1N014
ENSBTAP00000051948 ENSBTAP00000028127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]