SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028129 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028129
Domain Number 1 Region: 29-139
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 564-670
Classification Level Classification E-value
Superfamily SRCR-like 6.15e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000782
Further Details:      
 
Domain Number 3 Region: 790-901
Classification Level Classification E-value
Superfamily SRCR-like 1.11e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 4 Region: 673-780
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Domain Number 5 Region: 330-434
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 435-538
Classification Level Classification E-value
Superfamily SRCR-like 1.14e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028129   Gene: ENSBTAG00000039847   Transcript: ENSBTAT00000028129
Sequence length 1079
Comment pep:novel chromosome:UMD3.1:5:102324544:102353256:1 gene:ENSBTAG00000039847 transcript:ENSBTAT00000028129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQTQLLPQCNDSSSESAGSAASEESAPYCSGSRQLRLVDGGSPCAGRVEILDRSSWGTIC
DDGWDLDDARVVCRQLGCGEALDATVSSSFGSGSGPIWLDNVRCTGKESHVWRCPSRGWG
KHYCDHSEDAGVICSGMISLLPTSWENGKFQESWCLIRGTIRDGPIFPECPVAVSNELHT
LSFYKSLLFFSFPVVLPDTKIALFIIPVKPHTHSLCTGRLEEFILDDFNDIRELHLGAYL
EKVDNWEEGEWQWELMKKGVACDQTPSQDCLFFCALREMGKGSTVRWKMGGAQGIKALHP
FECLPLCSFFGHCSFQAPSQWVCSLFLLGFVRLAGGDGPCSGRVEVHSGEAWIPVSDGNF
KLSTAQVICAELGCGKAVSVLGHMPFRESNGRVWAEEFRCEGEEPKLWSCPRVPCPGGTC
HHSGAAQVVCSVYTDIRLMKNGTSSCEGQVEMNISGQWRALCASHWSLANANVVCHQLSC
GVAISTPNRAEGSDQLWKAWFHCSGTESFLWKCPVTALGVPDCSHGNTASVICSGNQTQV
LPQCNDSVSEPAGSAASEESAPNCSDSRQLRLVDGGGPCAGRVEILDQGSWGTICDDGWD
LDDARVVCRQLGCGEALNATRSAHFGAGSGPIWLDDLNCTGNEFHVWRCPSRGWGRHDCR
HKEDAGVICSVLEFLALRMVSEDQLCAGWLEVFYNGTWGSVCRSPMDDVTVSIICRQLGC
GDSGSLNSSVGLREGSRPRWVDLIQCRKTDTSLWQCPSDPWKYSSCSPKEEAYISCAGRR
PKSCPTAAPCTDREKLRLRGGDSECSGRVEVWHSGSWGTVCDDSWSLAEAEVVCQQLGCG
RALEALRAAAFGPGNGSIWLDEVRCWGRESSLWDCAAEPWGQSDCKHEQDAGVRCSGART
TLPLATAGTKTTSNPLPGIFSLPGVLCLFLGALLFLVLVILVTQLLRWRAERRALSSYEE
SLAEAVYEELDDFVTPSRGCGEEPPDQRTDVPAENYDDAEEVSVPGTLPASQGSEEKVPP
EKEDGVRSSQKGSSLNFSREVADPGEGEESPWLLQGKDGDPEYDDVELSTLGTPPVAFP
Download sequence
Identical sequences E3W9A0
ENSBTAP00000028129 ENSBTAP00000028129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]