SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028269 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028269
Domain Number 1 Region: 23-164
Classification Level Classification E-value
Superfamily EF-hand 7.87e-34
Family Calmodulin-like 0.000000675
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028269   Gene: ENSBTAG00000021218   Transcript: ENSBTAT00000028269
Sequence length 170
Comment pep:known chromosome:UMD3.1:25:26815266:26817727:1 gene:ENSBTAG00000021218 transcript:ENSBTAT00000028269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKAKRRAAAEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGR
LNVKNEELDAMMKEASGPINFTVFLNMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKF
LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Download sequence
Identical sequences Q0P571
ENSBTAP00000028269 NP_001069115.1.59421 NP_001069115.1.76553 XP_019843021.1.53367 ENSBTAP00000028269 9913.ENSBTAP00000028269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]