SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028299 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028299
Domain Number 1 Region: 11-150
Classification Level Classification E-value
Superfamily Ferritin-like 2.07e-16
Family Ferritin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028299   Gene: ENSBTAG00000021242   Transcript: ENSBTAT00000028299
Sequence length 179
Comment pep:known chromosome:UMD3.1:25:17011684:17025058:-1 gene:ENSBTAG00000021242 transcript:ENSBTAT00000028299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDNINREAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSIGPVIQKMWDQEKDHLKKFN
ELMVAFRVRPTVLMPFWNVVGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLME
KEPEKYEELLQVIKKFRDEELEHHDIGLEHDAELAPAYVVLKSVIQAGCKVAIYLSERL
Download sequence
Identical sequences Q58CW1
ENSBTAP00000028299 NP_001014849.1.59421 NP_001014849.1.76553 XP_005224753.1.76553 XP_005910748.1.15283 XP_010835414.1.44457 XP_010835415.1.44457 XP_014338774.1.15283 XP_014338775.1.15283 XP_019843845.1.53367 XP_019843846.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]