SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028350 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028350
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily EF-hand 8.59e-31
Family Calmodulin-like 0.0000000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028350   Gene: ENSBTAG00000021275   Transcript: ENSBTAT00000028350
Sequence length 191
Comment pep:known chromosome:UMD3.1:21:22043354:22046525:-1 gene:ENSBTAG00000021275 transcript:ENSBTAT00000028350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEHRSVEESLQARVSLEQILS
LPELKANPFKERICKVFSTSPSRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
GTLNREDLSQLVNCLTGESEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
PDFASSFKIVL
Download sequence
Identical sequences B1A8Z2 Q17QE5
ENSBTAP00000028350 ENSBTAP00000028350 ENSOARP00000013001 NP_001068901.1.59421 NP_001068901.1.76553 NP_001108237.1.54773 NP_001108237.1.66739 XP_005895215.1.15283 XP_010839346.1.44457 XP_013828434.2.57651 XP_019839514.1.53367 9913.ENSBTAP00000028350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]