SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028498 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028498
Domain Number 1 Region: 16-90
Classification Level Classification E-value
Superfamily EF-hand 0.000000000108
Family S100 proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028498   Gene: ENSBTAG00000021377   Transcript: ENSBTAT00000028498
Sequence length 104
Comment pep:known chromosome:UMD3.1:3:16827337:16829392:1 gene:ENSBTAG00000021377 transcript:ENSBTAT00000028498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQCRSANAEDAQELSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPS
NCGLEEKIANLGNCNDSKLEFGSFWELIGEAAKSVKLENAVQGS
Download sequence
Identical sequences L8HNK1 Q3MHP3
ENSBTAP00000028498 9913.ENSBTAP00000028498 NP_001073102.1.59421 NP_001073102.1.76553 XP_005203819.1.76553 XP_005910074.1.15283 XP_006041108.1.26621 XP_006041109.1.26621 XP_010836713.1.44457 XP_010836714.1.44457 XP_014338535.1.15283 XP_014338536.1.15283 XP_019810819.1.53367 XP_019810827.1.53367 ENSBTAP00000028498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]