SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028559 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028559
Domain Number 1 Region: 184-446
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-76
Family Protein kinases, catalytic subunit 0.000000000368
Further Details:      
 
Domain Number 2 Region: 77-213
Classification Level Classification E-value
Superfamily SH2 domain 9.69e-35
Family SH2 domain 0.00000174
Further Details:      
 
Domain Number 3 Region: 11-102
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-17
Family SH3-domain 0.0000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028559   Gene: ENSBTAG00000021424   Transcript: ENSBTAT00000028559
Sequence length 450
Comment pep:known chromosome:UMD3.1:21:34264921:34283286:-1 gene:ENSBTAG00000021424 transcript:ENSBTAT00000028559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLCPPETGLFLVRESTNYPGDYTLCV
SCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHYTSDADGLCTRLIKPKVMEGTVAAQ
DEFFRSGWALNMKDLKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKSGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK
NCWHLDAATRPSFLQLREQLERIKTHELHL
Download sequence
Identical sequences Q0VBZ0
ENSBTAP00000028559 NP_001068865.1.59421 NP_001068865.1.76553 XP_006080709.1.26621 XP_010841650.1.44457 XP_019839329.1.53367 9913.ENSBTAP00000028559 ENSBTAP00000028559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]