SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028687 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028687
Domain Number 1 Region: 322-575
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.33e-109
Family STAT DNA-binding domain 0.000000000166
Further Details:      
 
Domain Number 2 Region: 136-321
Classification Level Classification E-value
Superfamily STAT 5.1e-64
Family STAT 0.00000000791
Further Details:      
 
Domain Number 3 Region: 576-714
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-43
Family SH2 domain 0.0000000954
Further Details:      
 
Domain Number 4 Region: 1-120
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 5.36e-42
Family Transcription factor STAT-4 N-domain 0.0000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028687   Gene: ENSBTAG00000021523   Transcript: ENSBTAT00000028687
Sequence length 770
Comment pep:known chromosome:UMD3.1:19:43056660:43132624:-1 gene:ENSBTAG00000021523 transcript:ENSBTAT00000028687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEDAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEAAEPSAGGQFESLTFDMELTSECATSPM
Download sequence
Identical sequences F1MX38
9913.ENSBTAP00000028687 ENSBTAP00000028687 ENSBTAP00000028687 NP_001012689.2.59421 NP_001012689.2.76553 XP_015314312.1.76553 XP_019836841.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]