SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028693 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028693
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 1.12e-42
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028693   Gene: ENSBTAG00000021531   Transcript: ENSBTAT00000028693
Sequence length 188
Comment pep:known_by_projection chromosome:UMD3.1:21:8278718:8292031:-1 gene:ENSBTAG00000021531 transcript:ENSBTAT00000028693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQELSKLGLGNDMEVELQTLQLPVDYREVKQRVARIWEALQPQLVVHVGVDPAAKAIFLE
QCSKNRGYRDADIRGFRPECGVCLPDGPEVIASEVSMKAVSRRAAVQGVEVAFSRDAGRY
VCDYAYYLSLHHGNGCAALIHVPPLSPWLPASLLGKALQVLIQEMLEEIEKARAQNQKLS
VCSSSQGE
Download sequence
Identical sequences F1MX35
ENSBTAP00000028693 ENSBTAP00000028693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]