SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028731 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028731
Domain Number 1 Region: 21-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.42e-87
Family Eukaryotic proteases 0.000000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028731   Gene: ENSBTAG00000021565   Transcript: ENSBTAT00000028731
Sequence length 247
Comment pep:known chromosome:UMD3.1:4:106887844:106891620:1 gene:ENSBTAG00000021565 transcript:ENSBTAT00000028731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLLILAFVGAAVAFPSDDDDKIVGGYTCAENSVPYQVSLNAGYHFCGGSLINDQWVVS
AAHCYQYHIQVRLGEYNIDVLEGGEQFIDASKIIRHPKYSSWTLDNDILLIKLSTPAVIN
ARVSTLALPSACASAGTECLISGWGNTLSSGVNYPDLLQCLEAPLLSHADCEASYPGEIT
NNMICAGFLEGGKDSCQGDSGGPVACNGQLQGIVSWGYGCAQKGKPGVYTKVCNYVDWIQ
ETIAANS
Download sequence
Identical sequences A7YWU9
ENSBTAP00000028731 ENSBTAP00000028731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]