SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028761 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028761
Domain Number 1 Region: 39-198
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000314
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028761   Gene: ENSBTAG00000021583   Transcript: ENSBTAT00000028761
Sequence length 294
Comment pep:known chromosome:UMD3.1:24:20573848:20639449:1 gene:ENSBTAG00000021583 transcript:ENSBTAT00000028761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEETSPPLLGSSKPHLEKLTLGVTRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCVL
PEDLKNFYLMTNGFHMTWNVKLDEHTIPLGSMAINSISKLTQLNQSSMYSLPNAPTLADL
EDDIQEASENHPEKPHFDSRSVIFELDPCNGNGKVCLVYKRGKPGLAQDTEIWFLDRALY
WHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFNMYKPITYNTNLLTEETDS
FVNKLDPSKVFKSKNKTIIPKKKGPVQPAGGQKGPSGSASTSKSSSGSGNPVRK
Download sequence
Identical sequences A6QNU8
ENSBTAP00000028761 9913.ENSBTAP00000028761 ENSBTAP00000028761 NP_001095714.1.59421 NP_001095714.1.76553 XP_010848045.1.44457 XP_019842457.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]